PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009782268.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 228aa    MW: 25832.8 Da    PI: 9.3063
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009782268.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.32e-31140196158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep++VNaKQy++Il+RRq+Rak+e+e+kl  k+rkpylheS h hAl+R+Rg+gGrF
  XP_009782268.1 140 EEPVFVNAKQYHGILRRRQSRAKAESENKL-LKARKPYLHESWHLHALKRARGCGGRF 196
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-34138199IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.006139199IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.8E-26141196IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.0E-22142164IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860144164IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.0E-22173196IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MEGREKVSLY PDQKSGNGSE REKRIISKKV SRQQSSYNSE NEQPQKQSEV QSQSSSPVDE  60
LSLPGTVPPN MHYFMPSQFR DANAMAQTAY PYSDPYYRGI FAPYDMQPYP AQPYPAQSTV  120
QLQLMGIQQV GVPLPSDTIE EPVFVNAKQY HGILRRRQSR AKAESENKLL KARKPYLHES  180
WHLHALKRAR GCGGRFQSKK NDEYGDKSQA TVNIDSNKIE VTSSEDAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-20139203165NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009782268.11e-170PREDICTED: nuclear transcription factor Y subunit A-7-like
SwissprotQ84JP13e-56NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLM1AUU31e-114M1AUU3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000308131e-113(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66502333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.24e-53nuclear factor Y, subunit A7